Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3B Peptide - C-terminal region

PPP4R3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

Smek2, AW011752, AW557776, mKIAA1387

UniProt

Q922R5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP4R3B Rabbit Polyclonal Antibody (orb583562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598795

Preservative

Lyophilized powder

AA Sequence

DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cholinergic Receptor, Muscarinic 2 (CHRM2) ELISA Kit
RD-CHRM2-Mu-01 96 Tests

Mouse Cholinergic Receptor, Muscarinic 2 (CHRM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Cholinergic Receptor, Muscarinic 2 (CHRM2) ELISA Kit
RD-CHRM2-Mu-02 48 Tests

Mouse Cholinergic Receptor, Muscarinic 2 (CHRM2) ELISA Kit

Sign In for Pricing
View Details
Human WSB1 activation kit by CRISPRa
GA108758 1 Kit

Human WSB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Notch4 Mouse Gene Knockout Kit (CRISPR)
KN311127BN 1 Kit

Notch4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EFHC1 (NM_001172420) Human Over-expression Lysate
LY433359 100 µg

EFHC1 (NM_001172420) Human Over-expression Lysate

Sign In for Pricing
View Details
Nesprin 2 (SYNE2) Human Gene Knockout Kit (CRISPR)
KN213843LP 1 Kit

Nesprin 2 (SYNE2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details