SMR3B Peptide - middle region
SMR3B Peptide - middle region
Product Specifications
Product Name Alternative
MGC104379, P-B, PBII, PRL3, PROL3, SMR1B
UniProt
P02814
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMR3B Rabbit Polyclonal Antibody (orb324994) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006676
Preservative
Lyophilized powder
AA Sequence
PYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MAD4 (MXD4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90842d/imageurl/cf808855.webp)
CF808855 100 µg
MAD4 (MXD4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]
Sign In for Pricing
View Details 
BNC400326-100 1x 100 µL
Serum Amyloid A (SAA/326), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680198-500 1x 500 µL
Cytokeratin 18 (DA7), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 