Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMR3B Peptide - middle region

SMR3B Peptide - middle region

Product Specifications

Product Name Alternative

MGC104379, P-B, PBII, PRL3, PROL3, SMR1B

UniProt

P02814

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMR3B Rabbit Polyclonal Antibody (orb324994) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006676

Preservative

Lyophilized powder

AA Sequence

PYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SLC12A1 Antibody
RC-4665-01 50 μL

Recombinant SLC12A1 Antibody

Sign In for Pricing
View Details
Recombinant SLC12A1 Antibody
RC-4665-02 100 µL

Recombinant SLC12A1 Antibody

Sign In for Pricing
View Details
Recombinant SLC12A1 Antibody
RC-4665-03 1 mL

Recombinant SLC12A1 Antibody

Sign In for Pricing
View Details
(Z)-11- Hexadecenoic Acid
TRC-H293968-5MG 5 mg

(Z)-11- Hexadecenoic Acid

Sign In for Pricing
View Details
LST 3TM12 (SLCO1B7) Human Gene Knockout Kit (CRISPR)
KN420769 1 Kit

LST 3TM12 (SLCO1B7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS806070 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details