Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snap29 Peptide - middle region

Snap29 Peptide - middle region

Product Specifications

Product Name Alternative

Gs32, MGC105273

UniProt

Q9Z2P6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snap29 Rabbit Polyclonal Antibody (orb584364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446262

Preservative

Lyophilized powder

AA Sequence

NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd5 Mouse Monoclonal Antibody [Clone ID: CG16]
CL006FX 300 µg

Cd5 Mouse Monoclonal Antibody [Clone ID: CG16]

Sign In for Pricing
View Details
Ubiquilin (UBQLN1) (NM_013438) Human Over-expression Lysate
LC402265 20 µg

Ubiquilin (UBQLN1) (NM_013438) Human Over-expression Lysate

Sign In for Pricing
View Details
AM 0902
TRC-A634660-2.5MG 2.5 mg

AM 0902

Sign In for Pricing
View Details
ANTXR2 (NM_058172) Human Over-expression Lysate
LC403300 20 µg

ANTXR2 (NM_058172) Human Over-expression Lysate

Sign In for Pricing
View Details
MTR1A Antibody
8G398-AAT 50 µg

MTR1A Antibody

Sign In for Pricing
View Details
Conjugated Linoleic Acid Ethyl Ester-d5, 90% (Mixture of Isomers)
TRC-C685007-5MG 5 mg

Conjugated Linoleic Acid Ethyl Ester-d5, 90% (Mixture of Isomers)

Sign In for Pricing
View Details