Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snap29 Peptide - middle region

Snap29 Peptide - middle region

Product Specifications

Product Name Alternative

Gs32, MGC105273

UniProt

Q9Z2P6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snap29 Rabbit Polyclonal Antibody (orb584364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446262

Preservative

Lyophilized powder

AA Sequence

NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Psmd14 activation kit by CRISPRa
GA206342 1 Kit

Mouse Psmd14 activation kit by CRISPRa

Sign In for Pricing
View Details
Spermine synthase (SMS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]
TA503091BM 100 µL

Spermine synthase (SMS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704048 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Dinoseb-13C6
TRC-D480492-2.5MG 2.5 mg

Dinoseb-13C6

Sign In for Pricing
View Details
Recombinant Elongation factor 1 gamma Antibody
RC-15032-01 50 μL

Recombinant Elongation factor 1 gamma Antibody

Sign In for Pricing
View Details
Recombinant Elongation factor 1 gamma Antibody
RC-15032-02 100 µL

Recombinant Elongation factor 1 gamma Antibody

Sign In for Pricing
View Details