Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAP29 Peptide - middle region

SNAP29 Peptide - middle region

Product Specifications

Product Name Alternative

CEDNIK, FLJ21051, SNAP-29

UniProt

O95721

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNAP29 Rabbit Polyclonal Antibody (orb584365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004773

Preservative

Lyophilized powder

AA Sequence

QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (TS1), CF568 conjugate, 0.1mg/mL
BNC680627-500 1x 500 µL

Cytokeratin 8 (TS1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purified Anti-Human CD147 Antibody[HIM6]
E-AB-F1056A-01 25 µg

Purified Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Purified Anti-Human CD147 Antibody[HIM6]
E-AB-F1056A-02 100 µg

Purified Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
(E)-N,N'-bis(phenyl-d5)formimidamide
TRC-P881250-250MG 250 mg

(E)-N,N'-bis(phenyl-d5)formimidamide

Sign In for Pricing
View Details
NAPG (Center) Rabbit Polyclonal Antibody
AP52808PU-N 400 µL

NAPG (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGFL1 (NM_198541) Human Over-expression Lysate
LY403685 100 µg

IGFL1 (NM_198541) Human Over-expression Lysate

Sign In for Pricing
View Details