Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snf8 Peptide - N-terminal region

Snf8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D11moh34, MGC105799, RGD1310144

UniProt

Q5RK19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snf8 Rabbit Polyclonal Antibody (orb574418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007805

Preservative

Lyophilized powder

AA Sequence

GTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DDX5 (Tyr593) Polyclonal Antibody, Cy5.5 Conjugated
bs-8005R-Cy5.5 100 µL

Phospho-DDX5 (Tyr593) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Human F2 Matched Antibody Pair Set [ABP-Q-0605]
ABP-Q-0605 5 Plates

Human F2 Matched Antibody Pair Set [ABP-Q-0605]

Sign In for Pricing
View Details
Phospho-SGK1 (S78) Antibody
A40710-100UG 100 µg

Phospho-SGK1 (S78) Antibody

Sign In for Pricing
View Details
P57Kip2 (Mitotic Inhibitor/Suppressor Protein) Antibody
orb1712149 0.5 mL

P57Kip2 (Mitotic Inhibitor/Suppressor Protein) Antibody

Sign In for Pricing
View Details
Human IgG Fc-HRP conjugate (isotype control, non-immune), purified
20007-1-Fc-HP 0.1 mg

Human IgG Fc-HRP conjugate (isotype control, non-immune), purified

Sign In for Pricing
View Details
SPBC902.06 Antibody
orb857024 2 mg

SPBC902.06 Antibody

Sign In for Pricing
View Details