Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snf8 Peptide - N-terminal region

Snf8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D11moh34, MGC105799, RGD1310144

UniProt

Q5RK19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snf8 Rabbit Polyclonal Antibody (orb574418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007805

Preservative

Lyophilized powder

AA Sequence

GTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF9 Rabbit Polyclonal Antibody
orb393295-01 30 µL

GDF9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GDF9 Rabbit Polyclonal Antibody
orb393295-02 50 μL

GDF9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GDF9 Rabbit Polyclonal Antibody
orb393295-03 100 µL

GDF9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GDF9 Rabbit Polyclonal Antibody
orb393295-04 200 µL

GDF9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Mu 1 (GSTm1) CLIA Kit
abx496384-01 96 Tests

Mouse Glutathione S Transferase Mu 1 (GSTm1) CLIA Kit

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Mu 1 (GSTm1) CLIA Kit
abx496384-02 5x 96 Tests

Mouse Glutathione S Transferase Mu 1 (GSTm1) CLIA Kit

Sign In for Pricing
View Details