SNF8 Peptide - middle region
SNF8 Peptide - middle region
Product Specifications
Product Name Alternative
Dot3, EAP30, VPS22
UniProt
Q96H20
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNF8 Rabbit Polyclonal Antibody (orb583794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009172
Preservative
Lyophilized powder
AA Sequence
DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15318992 1 Vial
Lentiviral human PM20D2 shRNA (UAS) - Lentiviral human PM20D2 shRNA (UAS) (25)
Sign In for Pricing
View Details 
GTR15356678 1 Vial
Lentiviral human ARHGEF39 sgRNA gene knockout kit - Lentiviral human ARHGEF39 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details orb2816882-01 48 Tests
Mouse Nmt1 (Glycylpeptide N-tetradecanoyltransferase 1) ELISA Kit
Sign In for Pricing
View Details orb2816882-02 96 Tests
Mouse Nmt1 (Glycylpeptide N-tetradecanoyltransferase 1) ELISA Kit
Sign In for Pricing
View Details