Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNF8 Peptide - middle region

SNF8 Peptide - middle region

Product Specifications

Product Name Alternative

Dot3, EAP30, VPS22

UniProt

Q96H20

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNF8 Rabbit Polyclonal Antibody (orb583794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009172

Preservative

Lyophilized powder

AA Sequence

DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KLHDC1 Antibody
NBP1-82616-25ul 25 µL

Rabbit Polyclonal KLHDC1 Antibody

Sign In for Pricing
View Details
LIMK1 (LIM Domain Kinase 1, LIMK) (PE)
248202-PE 100 µL

LIMK1 (LIM Domain Kinase 1, LIMK) (PE)

Sign In for Pricing
View Details
Anti-Mouse IFN Beta (MIB-5E9.1) In Vivo Antibody - Low Endotoxin
ICH1124-25mg 25 mg

Anti-Mouse IFN Beta (MIB-5E9.1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
TSHZ1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G9]
TA809958BM 100 µL

TSHZ1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G9]

Sign In for Pricing
View Details
Recombinant Canine Minor Allergen Can f 2, N-His-SUMO
AP9C575-01 1 mg

Recombinant Canine Minor Allergen Can f 2, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Canine Minor Allergen Can f 2, N-His-SUMO
AP9C575-02 100 µg

Recombinant Canine Minor Allergen Can f 2, N-His-SUMO

Sign In for Pricing
View Details