SNRNP200 Peptide - N-terminal region
SNRNP200 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ASCC3L1, BRR2, FLJ11521, HELIC2, RP33, U5-200KD
UniProt
O75643
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRNP200 Rabbit Polyclonal Antibody (orb575956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_054733
Preservative
Lyophilized powder
AA Sequence
GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470096-100 1x 100 µL
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401081-500 1x 500 µL
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041587-500 1x 500 µL
CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400303-500 1x 500 µL
Neurofilament (NF-L) (NR-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details