Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPE Peptide - N-terminal region

SNRPE Peptide - N-terminal region

Product Specifications

Product Name Alternative

B-raf, SME, Sm-E

UniProt

P62304

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNRPE Rabbit Polyclonal Antibody (orb585554) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003085

Preservative

Lyophilized powder

AA Sequence

AYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHFR Human Gene Knockout Kit (CRISPR)
KN415377 1 Kit

CHFR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UE-01 25 µg

APC Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
APC Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UE-02 100 µg

APC Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702306 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
2-Amino-3-chlorobenzoic Acid
TRC-A603395-5G 5 g

2-Amino-3-chlorobenzoic Acid

Sign In for Pricing
View Details
NUDT16 (NM_152395) Human Recombinant Protein
TP306896M 100 µg

NUDT16 (NM_152395) Human Recombinant Protein

Sign In for Pricing
View Details