Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPE Peptide - N-terminal region

SNRPE Peptide - N-terminal region

Product Specifications

Product Name Alternative

B-raf, SME, Sm-E

UniProt

P62304

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNRPE Rabbit Polyclonal Antibody (orb585554) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003085

Preservative

Lyophilized powder

AA Sequence

AYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2AC19 Human Gene Knockout Kit (CRISPR)
KN400688 1 Kit

H2AC19 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF405S conjugate, 0.1mg/mL
BNC042894-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mabuterol Hydrochloride
TRC-M104010-2.5MG 2.5 mg

Mabuterol Hydrochloride

Sign In for Pricing
View Details
ACTG2 Rabbit Polyclonal Antibody
TA361463 100 µL

ACTG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF568 conjugate, 0.1mg/mL
BNC682711-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RANBP3 Antibody (Biotin)
KB-28588-01 50 μL

RANBP3 Antibody (Biotin)

Sign In for Pricing
View Details