SNRPN Peptide - N-terminal region
SNRPN Peptide - N-terminal region
Product Specifications
Product Name Alternative
DKFZp686C0927, DKFZp686M12165, DKFZp761I1912, DKFZp762N022, FLJ33569, FLJ36996, FLJ39265, HCERN3, MGC29886, PWCR, RT-LI, SM-D, SMN, SNRNP-N, SNURF-SNRPN, sm-N
UniProt
P63162
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRPN Rabbit Polyclonal Antibody (orb577593) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003088
Preservative
Lyophilized powder
AA Sequence
DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470994-100 1x 100 µL
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040146-100 1x 100 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940460-100 1x 100 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471986-100 1x 100 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details