Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sntg1 Peptide - N-terminal region

Sntg1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4933426D16Rik, G1SYN, SYN4

UniProt

Q925E1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sntg1 Rabbit Polyclonal Antibody (orb326182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081947

Preservative

Lyophilized powder

AA Sequence

KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUM1 (IRF4) (NM_002460) Human Recombinant Protein
TP304876L 1 mg

MUM1 (IRF4) (NM_002460) Human Recombinant Protein

Sign In for Pricing
View Details
CREB1 Rabbit Polyclonal Antibody
AP21085PU-N 100 µg

CREB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIAPH2 Antibody
KC-38751-01 50 μL

DIAPH2 Antibody

Sign In for Pricing
View Details
DIAPH2 Antibody
KC-38751-02 100 µL

DIAPH2 Antibody

Sign In for Pricing
View Details
DIAPH2 Antibody
KC-38751-03 1 mL

DIAPH2 Antibody

Sign In for Pricing
View Details
HOXD1 (N-term) Rabbit Polyclonal Antibody
AP52083PU-N 400 µL

HOXD1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details