Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sntg1 Peptide - N-terminal region

Sntg1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4933426D16Rik, G1SYN, SYN4

UniProt

Q925E1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sntg1 Rabbit Polyclonal Antibody (orb326182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081947

Preservative

Lyophilized powder

AA Sequence

KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLVRB (NM_000713) Human Over-expression Lysate
LY400239 100 µg

BLVRB (NM_000713) Human Over-expression Lysate

Sign In for Pricing
View Details
RET Rabbit Monoclonal Antibody
TA422664 100 µL

RET Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FEN1 Antibody
KC-6171-01 50 μL

FEN1 Antibody

Sign In for Pricing
View Details
FEN1 Antibody
KC-6171-02 100 µL

FEN1 Antibody

Sign In for Pricing
View Details
FEN1 Antibody
KC-6171-03 1 mL

FEN1 Antibody

Sign In for Pricing
View Details
Fluoro NAD/NADH Detection Kit by Cell Technology
FLNADH100-3 500 Tests

Fluoro NAD/NADH Detection Kit by Cell Technology

Sign In for Pricing
View Details