Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx10 Peptide - middle region

Snx10 Peptide - middle region

Product Specifications

Product Name Alternative

2410004M09Rik

UniProt

Q9CWT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snx10 Rabbit Polyclonal Antibody (orb325944) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120820

Preservative

Lyophilized powder

AA Sequence

DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPD Antibody, HRP conjugated
A25519-100UG 100 µg

HPD Antibody, HRP conjugated

Sign In for Pricing
View Details
SCKL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
43166151 3x 1.0 µg DNA

SCKL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Research Grade Anti-Human IL11RA Antibody (Hu16E12)
MBS1581557-01 0.1 mg

Research Grade Anti-Human IL11RA Antibody (Hu16E12)

Sign In for Pricing
View Details
Research Grade Anti-Human IL11RA Antibody (Hu16E12)
MBS1581557-02 1 mg

Research Grade Anti-Human IL11RA Antibody (Hu16E12)

Sign In for Pricing
View Details
Research Grade Anti-Human IL11RA Antibody (Hu16E12)
MBS1581557-03 5x 1 mg

Research Grade Anti-Human IL11RA Antibody (Hu16E12)

Sign In for Pricing
View Details
Vsig2 AAV siRNA Pooled Vector
50206166 1.0 µg

Vsig2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details