Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx10 Peptide - middle region

Snx10 Peptide - middle region

Product Specifications

Product Name Alternative

2410004M09Rik

UniProt

Q9CWT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snx10 Rabbit Polyclonal Antibody (orb325944) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120820

Preservative

Lyophilized powder

AA Sequence

DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Endotrophin ELISA Kit
MBS7280312-01 48 Well

Porcine Endotrophin ELISA Kit

Sign In for Pricing
View Details
Porcine Endotrophin ELISA Kit
MBS7280312-02 96 Well

Porcine Endotrophin ELISA Kit

Sign In for Pricing
View Details
Porcine Endotrophin ELISA Kit
MBS7280312-03 5x 96 Well

Porcine Endotrophin ELISA Kit

Sign In for Pricing
View Details
Porcine Endotrophin ELISA Kit
MBS7280312-04 10x 96 Well

Porcine Endotrophin ELISA Kit

Sign In for Pricing
View Details
CCRK CRISPRa sgRNA lentivector (set of three targets)(Human)
15434121 3x 1.0µg DNA

CCRK CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
IL8 ELISA Kit (Human) (OKCD05868)
OKCD05868 96 Well

IL8 ELISA Kit (Human) (OKCD05868)

Sign In for Pricing
View Details