Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX12 Peptide - middle region

SNX12 Peptide - middle region

Product Specifications

Product Name Alternative

MGC118982, MGC118983

UniProt

Q3SYF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX12 Rabbit Polyclonal Antibody (orb331200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037478

Preservative

Lyophilized powder

AA Sequence

VRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galanin ELISA Kit (Colorimetric)
NBP3-31739 1 Kit

Human Galanin ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Biotin-Linked Anti-Interleukin 1 Alpha (IL1A)
FY-AB43002-01 1 mL

Biotin-Linked Anti-Interleukin 1 Alpha (IL1A)

Sign In for Pricing
View Details
Biotin-Linked Anti-Interleukin 1 Alpha (IL1A)
FY-AB43002-02 100 µL

Biotin-Linked Anti-Interleukin 1 Alpha (IL1A)

Sign In for Pricing
View Details
Biotin-Linked Anti-Interleukin 1 Alpha (IL1A)
FY-AB43002-03 200 µL

Biotin-Linked Anti-Interleukin 1 Alpha (IL1A)

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (HRP)
MBS6180633-01 0.1 mL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (HRP)

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (HRP)
MBS6180633-02 5x 0.1 mL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (HRP)

Sign In for Pricing
View Details