Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX12 Peptide - middle region

SNX12 Peptide - middle region

Product Specifications

Product Name Alternative

MGC118982, MGC118983

UniProt

Q3SYF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX12 Rabbit Polyclonal Antibody (orb331200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037478

Preservative

Lyophilized powder

AA Sequence

VRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7006-3p miRNA Mimic
CMM1484-01 5 nmol

Mmu-miR-7006-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-7006-3p miRNA Mimic
CMM1484-02 10 nmol

Mmu-miR-7006-3p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans amt-3 Protein (aa 1-687)
VAng-Ly3009-inquire Inquire

Recombinant Caenorhabditis Elegans amt-3 Protein (aa 1-687)

Sign In for Pricing
View Details
Eftud2 Antibody
orb621003-01 50 μL

Eftud2 Antibody

Sign In for Pricing
View Details
Eftud2 Antibody
orb621003-02 100 µL

Eftud2 Antibody

Sign In for Pricing
View Details
CEACAM16 Protein Vector (Human) (pPM-C-HA)
15807021 500 ng

CEACAM16 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details