Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX4 Peptide - C-terminal region

SNX4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATG24B

UniProt

O95219

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX4 Rabbit Polyclonal Antibody (orb585233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003785

Preservative

Lyophilized powder

AA Sequence

LFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAX1 (HS1BP1, HCLS1-associated Protein X-1, HS1-associating Protein X-1, HS1-binding Protein 1) (Biotin)
127732-Biotin 100 µL

HAX1 (HS1BP1, HCLS1-associated Protein X-1, HS1-associating Protein X-1, HS1-binding Protein 1) (Biotin)

Sign In for Pricing
View Details
Olr1337 3'UTR GFP Stable Cell Line
TU264643 1.0 mL

Olr1337 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
VSTM5 shRNA Plasmid (m)
sc-108612-SH 20 µg

VSTM5 shRNA Plasmid (m)

Sign In for Pricing
View Details
CLRN1 CytoSection
TS410388P5 25 Slides

CLRN1 CytoSection

Sign In for Pricing
View Details
STXBP5 Rabbit pAb
E45R22897N-100 100 µL

STXBP5 Rabbit pAb

Sign In for Pricing
View Details
ELISA Kit For Transforming growth factor beta-3 proprotein
E1215r 96 Tests

ELISA Kit For Transforming growth factor beta-3 proprotein

Sign In for Pricing
View Details