Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX4 Peptide - C-terminal region

SNX4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATG24B

UniProt

O95219

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX4 Rabbit Polyclonal Antibody (orb585233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003785

Preservative

Lyophilized powder

AA Sequence

LFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM35A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0721105 3x 1.0 µg

FAM35A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Flaccidoside III
T79980-01 5 mg

Flaccidoside III

Sign In for Pricing
View Details
Flaccidoside III
T79980-02 50 mg

Flaccidoside III

Sign In for Pricing
View Details
SNORD113-1 CRISPR Knock Out 293T Cell Line (Human)
44691141 1x 10^6 Cells / 1.0 mL

SNORD113-1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CD38 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0402305 3x 1.0 µg

CD38 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TUBA4A
529368-01 100 µL

TUBA4A

Sign In for Pricing
View Details