Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx5 Peptide - N-terminal region

Snx5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP23-35E16.2, 0910001N05Rik, 1810032P22Rik, AU019504, D2Ertd52e

UniProt

Q9D8U8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

BAC37388

Preservative

Lyophilized powder

AA Sequence

LQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDTLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO1 Mouse Monoclonal Antibody [Clone ID: 7A6]
AM06311SU-N 100 µL

RSPO1 Mouse Monoclonal Antibody [Clone ID: 7A6]

Sign In for Pricing
View Details
Recombinant Hsp27 Antibody
RC-4811-01 50 μL

Recombinant Hsp27 Antibody

Sign In for Pricing
View Details
Recombinant Hsp27 Antibody
RC-4811-02 100 µL

Recombinant Hsp27 Antibody

Sign In for Pricing
View Details
Recombinant Hsp27 Antibody
RC-4811-03 1 mL

Recombinant Hsp27 Antibody

Sign In for Pricing
View Details
PPIB Antibody
KC-24907-01 50 μL

PPIB Antibody

Sign In for Pricing
View Details
PPIB Antibody
KC-24907-02 100 µL

PPIB Antibody

Sign In for Pricing
View Details