Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx5 Peptide - N-terminal region

Snx5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP23-35E16.2, 0910001N05Rik, 1810032P22Rik, AU019504, D2Ertd52e

UniProt

Q9D8U8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

BAC37388

Preservative

Lyophilized powder

AA Sequence

LQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDTLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UCMA activation kit by CRISPRa
GA116587 1 Kit

Human UCMA activation kit by CRISPRa

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3530), CF640R conjugate, 0.1mg/mL
BNC403530-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3530), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIRO2 (RHOT2) Human Gene Knockout Kit (CRISPR)
KN204823BN 1 Kit

MIRO2 (RHOT2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF568 conjugate, 0.1mg/mL
BNC681645-500 1x 500 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGP9.5 Recombinant Chimeric Antibody Antibody
HA610345 100 µL

PGP9.5 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
ICA1 (NM_001136020) Human Over-expression Lysate
LC427769 20 µg

ICA1 (NM_001136020) Human Over-expression Lysate

Sign In for Pricing
View Details