Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX8 Peptide - C-terminal region

SNX8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mvp1

UniProt

B2RDT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX8 Rabbit Polyclonal Antibody (orb331193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037453

Preservative

Lyophilized powder

AA Sequence

KYSLMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1110059E24Rik (NM_025423) Mouse Tagged ORF Clone
MG201157 10 µg

1110059E24Rik (NM_025423) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KPNA2 Rabbit Monoclonal Antibody [Clone ID: 24GB5955]
TA424910 100 µL

KPNA2 Rabbit Monoclonal Antibody [Clone ID: 24GB5955]

Sign In for Pricing
View Details
NDUFS8 Human Gene Knockout Kit (CRISPR)
KN416036 1 Kit

NDUFS8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTEN Rabbit Polyclonal Antibody
AP02597PU-N 100 µL

PTEN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Eicosane
TRC-E477490-1G 1 g

Eicosane

Sign In for Pricing
View Details
Galanthus nivalis Gel -GNA- Immobilized Lectin
AK-7401-1 1 mL/Kit

Galanthus nivalis Gel -GNA- Immobilized Lectin

Sign In for Pricing
View Details