Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX8 Peptide - C-terminal region

SNX8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mvp1

UniProt

B2RDT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX8 Rabbit Polyclonal Antibody (orb331193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037453

Preservative

Lyophilized powder

AA Sequence

KYSLMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(p-Iodophenyl)butyric Acid
TRC-I717540-5G 5 g

4-(p-Iodophenyl)butyric Acid

Sign In for Pricing
View Details
Ssxb5 Mouse Gene Knockout Kit (CRISPR)
KN516790 1 Kit

Ssxb5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC39A3 Human Gene Knockout Kit (CRISPR)
KN401293 1 Kit

SLC39A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cholestane-3Beta,5Alpha,6Alpha-triol-d7
TRC-C431747-5MG 5 mg

Cholestane-3Beta,5Alpha,6Alpha-triol-d7

Sign In for Pricing
View Details
CD34 Monoclonal Antibody
AN006960L-01 25 µL

CD34 Monoclonal Antibody

Sign In for Pricing
View Details