Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORD Peptide - N-terminal region

SORD Peptide - N-terminal region

Product Specifications

Product Name Alternative

SORD1

UniProt

Q00796

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SORD Rabbit Polyclonal Antibody (orb584902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003095

Preservative

Lyophilized powder

AA Sequence

ASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TFF1 (Trefoil Factor 1) ELISA Kit
ER21707 96 Tests

Rat TFF1 (Trefoil Factor 1) ELISA Kit

Sign In for Pricing
View Details
ROPN1 Protein Vector (Mouse) (pPB-N-His)
PV225087 500 ng

ROPN1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human BMP2 ELISA Kit
55R-1560 1 kit

Human BMP2 ELISA Kit

Sign In for Pricing
View Details
PAFAH1B1 Antibody, FITC conjugated
MBS7048824-01 0.05 mg

PAFAH1B1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PAFAH1B1 Antibody, FITC conjugated
MBS7048824-02 0.1 mg

PAFAH1B1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PAFAH1B1 Antibody, FITC conjugated
MBS7048824-03 5x 0.1 mg

PAFAH1B1 Antibody, FITC conjugated

Sign In for Pricing
View Details