Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORD Peptide - N-terminal region

SORD Peptide - N-terminal region

Product Specifications

Product Name Alternative

SORD1

UniProt

Q00796

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SORD Rabbit Polyclonal Antibody (orb584902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003095

Preservative

Lyophilized powder

AA Sequence

ASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LETMD1 antibody
STJ24397 100 µl

Anti-LETMD1 antibody

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2149007-01 0.1 mL

PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2149007-02 0.2 mL

PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2149007-03 0.5 mL

PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2149007-04 1 mL

PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2149007-05 5 mL

PE-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details