Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX1 Peptide - C-terminal region

SOX1 Peptide - C-terminal region

Product Specifications

UniProt

O00570

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOX1 Rabbit Polyclonal Antibody (orb329775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005977

Preservative

Lyophilized powder

AA Sequence

ALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octyl cis-9-Octadecenoate
TRC-O845803-5G 5 g

Octyl cis-9-Octadecenoate

Sign In for Pricing
View Details
FAM115C (TCAF2) (NM_001130025) Human Over-expression Lysate
LC427110 20 µg

FAM115C (TCAF2) (NM_001130025) Human Over-expression Lysate

Sign In for Pricing
View Details
p107 (RBL1) (NM_183404) Human Over-expression Lysate
LY403655 100 µg

p107 (RBL1) (NM_183404) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit
E-EL-H6081-01 24 Tests

Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit

Sign In for Pricing
View Details
Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit
E-EL-H6081-02 48 Tests

Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit

Sign In for Pricing
View Details
Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit
E-EL-H6081-03 96 Tests

Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit

Sign In for Pricing
View Details