What is the catalog number for SOX1 Peptide - N-terminal region?

The catalog number for SOX1 Peptide - N-terminal region is orb2008906.

What sizes are available for SOX1 Peptide - N-terminal region?

SOX1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is SOX1 Peptide - N-terminal region in stock?

SOX1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

SOX1 Peptide - N-terminal region

Product Specifications

UniProt

O00570

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005977

Preservative

Lyophilized powder

AA Sequence

GGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LV812500 1.0 µg DNA

AK3L1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing

View Details

MBS6485592-01 0.1 mL

Luteinizing Hormone (LH) (MaxLight 750)

Sign In for Pricing

View Details

MBS6485592-02 5x 0.1 mL

Luteinizing Hormone (LH) (MaxLight 750)

Sign In for Pricing

View Details

AMM21443VCF 100 µg

PGP9.5 (UCHL1) Mouse Monoclonal Antibody [Clone ID: LBI7D4]

Sign In for Pricing

View Details

NB110-93513-0.025mg 0.025 mg

Mouse Monoclonal S1P1/EDG-1 Antibody (MM0045-21L9)

Sign In for Pricing

View Details

11536106 1 µg

AGPS AAV Vector (Rat) (CMV)

Sign In for Pricing

View Details