Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX1 Peptide - N-terminal region

SOX1 Peptide - N-terminal region

Product Specifications

UniProt

O00570

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005977

Preservative

Lyophilized powder

AA Sequence

GGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLSTN1-set siRNA/shRNA/RNAi Lentivector (Human)
16383091 4x 500 ng

CLSTN1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG)
RPC22531-01 20 µg

Recombinant Bacillus subtilis UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG)
RPC22531-02 100 µg

Recombinant Bacillus subtilis UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG)
RPC22531-03 1 mg

Recombinant Bacillus subtilis UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG)

Sign In for Pricing
View Details
Goat Transforming Growth Factor Beta (TGF-β) ELISA kit
EIA06427Go 1 Kit

Goat Transforming Growth Factor Beta (TGF-β) ELISA kit

Sign In for Pricing
View Details
Rat Histone ELISA Kit
MBS747031-01 48 Well

Rat Histone ELISA Kit

Sign In for Pricing
View Details