Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX13 Peptide - middle region

SOX13 Peptide - middle region

Product Specifications

Product Name Alternative

ICA12, MGC117216, SRY-box 13, Sox-13

UniProt

Q9UN79

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOX13 Rabbit Polyclonal Antibody (orb574796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005677

Preservative

Lyophilized powder

AA Sequence

PVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RNase L/Rnasel Antibody Picoband®, Carrier-free
A02521-1-carrier-free 100 µg/Vial

Anti-RNase L/Rnasel Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Recombinant Mycobacterium Marinum rpsM Protein (aa 1-124)
VAng-Yyj4568-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Marinum rpsM Protein (aa 1-124)

Sign In for Pricing
View Details
TTC17 (NM_018259) Human Untagged Clone
SC125412 10 µg

TTC17 (NM_018259) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Coprinopsis cinerea Vesicular-fusion protein SEC17 (SEC17)
MBS1144700-01 0.05 mg (E-Coli)

Recombinant Coprinopsis cinerea Vesicular-fusion protein SEC17 (SEC17)

Sign In for Pricing
View Details
Recombinant Coprinopsis cinerea Vesicular-fusion protein SEC17 (SEC17)
MBS1144700-02 0.05 mg (Yeast)

Recombinant Coprinopsis cinerea Vesicular-fusion protein SEC17 (SEC17)

Sign In for Pricing
View Details
Recombinant Coprinopsis cinerea Vesicular-fusion protein SEC17 (SEC17)
MBS1144700-03 0.2 mg (E-Coli)

Recombinant Coprinopsis cinerea Vesicular-fusion protein SEC17 (SEC17)

Sign In for Pricing
View Details