Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX5 Peptide - N-terminal region

SOX5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L-SOX5, MGC35153

UniProt

P35711

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOX5 Rabbit Polyclonal Antibody (orb329719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008871

Preservative

Lyophilized powder

AA Sequence

VSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(4,5-Dihydro-1h-imidazol-2-yl)pyridine
TRC-D177851-250MG 250 mg

2-(4,5-Dihydro-1h-imidazol-2-yl)pyridine

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501276 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
CD97 (ADGRE5) Human Knockdown Lysate
LY300322 100 µg

CD97 (ADGRE5) Human Knockdown Lysate

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
RDR-VEGFR1-Mu-01 96 Tests

Mouse Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
RDR-VEGFR1-Mu-02 48 Tests

Mouse Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details
Human TLCD3A activation kit by CRISPRa
GA112678 1 Kit

Human TLCD3A activation kit by CRISPRa

Sign In for Pricing
View Details