Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX5 Peptide - N-terminal region

SOX5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L-SOX5, MGC35153

UniProt

P35711

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOX5 Rabbit Polyclonal Antibody (orb329719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008871

Preservative

Lyophilized powder

AA Sequence

VSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Arginine-L-phenylalanine-L-arginine-L-tryptophan-L-proline-L-tyrosine-L-arginine-L-isoleucine-L-arginine-L-glutamic acid-L-phenylalanine TFA Salt (95%)
TRC-A169125-25MG 25 mg

L-Arginine-L-phenylalanine-L-arginine-L-tryptophan-L-proline-L-tyrosine-L-arginine-L-isoleucine-L-arginine-L-glutamic acid-L-phenylalanine TFA Salt (95%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS626750 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Laninamivir Octanoate
TRC-L174010-1MG 1 mg

Laninamivir Octanoate

Sign In for Pricing
View Details
IL31 Mouse
OM296413-01 10 µg

IL31 Mouse

Sign In for Pricing
View Details
IL31 Mouse
OM296413-02 2 µg

IL31 Mouse

Sign In for Pricing
View Details
IL31 Mouse
OM296413-03 1 mg

IL31 Mouse

Sign In for Pricing
View Details