Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPA17 Peptide - N-terminal region

SPA17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SP17, SP17-1, CT22

UniProt

Q15506

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPA17 Rabbit Polyclonal Antibody (orb325884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059121

Preservative

Lyophilized powder

AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydrodivanillin (~90%, contains up to 10% unknown inorganics)
TRC-D233040-1G 1 g

Dehydrodivanillin (~90%, contains up to 10% unknown inorganics)

Sign In for Pricing
View Details
PRPF3 Polyclonal Antibody
E-AB-52769-01 20 µL

PRPF3 Polyclonal Antibody

Sign In for Pricing
View Details
PRPF3 Polyclonal Antibody
E-AB-52769-02 60 µL

PRPF3 Polyclonal Antibody

Sign In for Pricing
View Details
PRPF3 Polyclonal Antibody
E-AB-52769-03 120 µL

PRPF3 Polyclonal Antibody

Sign In for Pricing
View Details
PRPF3 Polyclonal Antibody
E-AB-52769-04 200 µL

PRPF3 Polyclonal Antibody

Sign In for Pricing
View Details
Calpastatin (CAST/1550), CF647 conjugate, 0.1mg/mL
BNC471550-100 1x 100 µL

Calpastatin (CAST/1550), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details