Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPA17 Peptide - N-terminal region

SPA17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SP17, SP17-1, CT22

UniProt

Q15506

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPA17 Rabbit Polyclonal Antibody (orb325884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059121

Preservative

Lyophilized powder

AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human XPC activation kit by CRISPRa
GA105169 1 Kit

Human XPC activation kit by CRISPRa

Sign In for Pricing
View Details
2-Hydroxyethyl Phosphate-d4
TRC-H942052-25MG 25 mg

2-Hydroxyethyl Phosphate-d4

Sign In for Pricing
View Details
D-[UL-13C6]Glucosamine Hydrochloride
TRC-G515102-1MG 1 mg

D-[UL-13C6]Glucosamine Hydrochloride

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF594 conjugate, 0.1mg/mL
BNC941126-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CD138 ELISA Kit, 1 x 48-well (pre-coated)
EA102169 1x 48 Well (Pre-Coated)

Human CD138 ELISA Kit, 1 x 48-well (pre-coated)

Sign In for Pricing
View Details
FGFBP2 (NM_031950) Human Recombinant Protein
TP306392L 1 mg

FGFBP2 (NM_031950) Human Recombinant Protein

Sign In for Pricing
View Details