Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD58, Human (HEK293, His)

CD58, a glycoprotein, is also known as lymphocyte-function antigen 3 (LFA-3) . CD58 is a costimulatory receptor, and can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells) . The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells[1]. CD58 Protein, Human (HEK293, His) is the recombinant human-derived CD58 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD58 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd58-protein-human-hek-293-his.html

Purity

99.90

Smiles

FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

Molecular Formula

965 (Gene_ID) AAH05930 (F29-R215) (Accession)

Molecular Weight

30-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-100 1x 100 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF640R conjugate, 0.1mg/mL
BNC401372-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF647 conjugate, 0.1mg/mL
BNC471469-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details