Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG6 Peptide - middle region

SPAG6 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp434I153, MGC26276, Repro-SA-1, pf16

UniProt

O75602

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG6 Rabbit Polyclonal Antibody (orb582253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758442

Preservative

Lyophilized powder

AA Sequence

LQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloroacetanilide
TRC-C325370-5G 5 g

3-Chloroacetanilide

Sign In for Pricing
View Details
Recombinant 14-3-3 sigma Antibody
RC-15259-01 50 μL

Recombinant 14-3-3 sigma Antibody

Sign In for Pricing
View Details
Recombinant 14-3-3 sigma Antibody
RC-15259-02 100 µL

Recombinant 14-3-3 sigma Antibody

Sign In for Pricing
View Details
Recombinant 14-3-3 sigma Antibody
RC-15259-03 1 mL

Recombinant 14-3-3 sigma Antibody

Sign In for Pricing
View Details
DNase II (DNASE2) (NM_001375) Human Over-expression Lysate
LC419982 20 µg

DNase II (DNASE2) (NM_001375) Human Over-expression Lysate

Sign In for Pricing
View Details
CD38 Mouse Monoclonal Antibody [Clone ID: OTI6B3]
CF810517 100 µg

CD38 Mouse Monoclonal Antibody [Clone ID: OTI6B3]

Sign In for Pricing
View Details