Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA9 Peptide - N-terminal region

SPATA9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ35906, NYD-SP16

UniProt

Q9BWV2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA9 Rabbit Polyclonal Antibody (orb580958) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114158

Preservative

Lyophilized powder

AA Sequence

FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1S antibody
MBS5317637-01 1 mg

C1S antibody

Sign In for Pricing
View Details
C1S antibody
MBS5317637-02 5x 1 mg

C1S antibody

Sign In for Pricing
View Details
Lentiviral mouse Mef2c shRNA (UAS) - Lentiviral mouse Mef2c shRNA (UAS) (25)
GTR15282461 1 Vial

Lentiviral mouse Mef2c shRNA (UAS) - Lentiviral mouse Mef2c shRNA (UAS) (25)

Sign In for Pricing
View Details
Human CNGA1 Protein Lysate
MBS139654-01 0.02 mg

Human CNGA1 Protein Lysate

Sign In for Pricing
View Details
Human CNGA1 Protein Lysate
MBS139654-02 5x 0.02 mg

Human CNGA1 Protein Lysate

Sign In for Pricing
View Details
XPG (8H7) FITC
sc-13563 FITC 200 µg/mL

XPG (8H7) FITC

Sign In for Pricing
View Details