Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA9 Peptide - N-terminal region

SPATA9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ35906, NYD-SP16

UniProt

Q9BWV2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA9 Rabbit Polyclonal Antibody (orb580958) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114158

Preservative

Lyophilized powder

AA Sequence

FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Interleukin 1 Receptor Like Protein 1 (IL1RL1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031330 96 Tests

Multiplex Assay Kit for Interleukin 1 Receptor Like Protein 1 (IL1RL1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Usp2 (NM_053774) Rat Tagged ORF Clone Lentiviral Particle
RR204666L3V 200 µL

Usp2 (NM_053774) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sitagliptin 500mg
A14377-500 500 mg

Sitagliptin 500mg

Sign In for Pricing
View Details
Human TONSL Pre-designed siRNA Set B
SI017161B 1 Each

Human TONSL Pre-designed siRNA Set B

Sign In for Pricing
View Details
Isl2 (NM_027397) Mouse Tagged ORF Clone
MR225759 10 µg

Isl2 (NM_027397) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRIM10, CT (TRIM10, RFB30, RNF9, Tripartite motif-containing protein 10, B30-RING finger protein, RING finger protein 9) (MaxLight 405) discontinued
043212-ML405 100 µL

TRIM10, CT (TRIM10, RFB30, RNF9, Tripartite motif-containing protein 10, B30-RING finger protein, RING finger protein 9) (MaxLight 405) discontinued

Sign In for Pricing
View Details