Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDEF Peptide - C-terminal region

SPDEF Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDEF, RP11-375E1__A.3, bA375E1.3

UniProt

O95238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDEF Rabbit Polyclonal Antibody (orb330032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036523

Preservative

Lyophilized powder

AA Sequence

FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX9 / SRY-box 9 (SOX9/2287R), CF647 conjugate, 0.1mg/mL
BNC472287-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2287R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chgb Mouse Gene Knockout Kit (CRISPR)
KN503260 1 Kit

Chgb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IKK alpha (CHUK) pSer176 Rabbit Polyclonal Antibody
AP20953PU-N 100 µg

IKK alpha (CHUK) pSer176 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(R,S)-Equol 7-beta-D-Glucuronide Sodium Salt
TRC-E593005-1MG 1 mg

(R,S)-Equol 7-beta-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details
Propoxycarbazone Sodium Salt
TRC-P831308-500MG 500 mg

Propoxycarbazone Sodium Salt

Sign In for Pricing
View Details
Human C21orf70 (FAM207A) activation kit by CRISPRa
GA113868 1 Kit

Human C21orf70 (FAM207A) activation kit by CRISPRa

Sign In for Pricing
View Details