Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPART Peptide - middle region

SPART Peptide - middle region

Product Specifications

Product Name Alternative

SPG20, TAHCCP1

UniProt

Q8N0X7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPART Rabbit Polyclonal Antibody (orb330801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055902

Preservative

Lyophilized powder

AA Sequence

ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS501955 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705934 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
IL21 Antibody
KC-1708-01 50 μL

IL21 Antibody

Sign In for Pricing
View Details
IL21 Antibody
KC-1708-02 100 µL

IL21 Antibody

Sign In for Pricing
View Details
IL21 Antibody
KC-1708-03 1 mL

IL21 Antibody

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-18678-01 20 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details