Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPART Peptide - middle region

SPART Peptide - middle region

Product Specifications

Product Name Alternative

SPG20, TAHCCP1

UniProt

Q8N0X7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPART Rabbit Polyclonal Antibody (orb330801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055902

Preservative

Lyophilized powder

AA Sequence

ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Bovine IgG Antibody
HAF-411-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Bovine IgG Antibody

Sign In for Pricing
View Details
HSPBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]
TA503554AM 100 µL

HSPBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Spleen
CS800741 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details
ANKMY2 Human Gene Knockout Kit (CRISPR)
KN206770 1 Kit

ANKMY2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR149 (NM_001038705) Human Recombinant Protein
TP323772L 1 mg

GPR149 (NM_001038705) Human Recombinant Protein

Sign In for Pricing
View Details
IWS1 Rabbit Polyclonal Antibody
TA372052 100 µL

IWS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details