Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPHK1 Peptide - middle region

SPHK1 Peptide - middle region

Product Specifications

Product Name Alternative

SPHK

UniProt

Q9NYA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPHK1 Rabbit Polyclonal Antibody (orb331232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136073

Preservative

Lyophilized powder

AA Sequence

DVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acta1b (FITC)
554331-01 50 µg

Acta1b (FITC)

Sign In for Pricing
View Details
Acta1b (FITC)
554331-02 100 µg

Acta1b (FITC)

Sign In for Pricing
View Details
Ahx-CES
HY-P11030 1 Each

Ahx-CES

Sign In for Pricing
View Details
Sacubitril calcium salt
314262 200.0mg

Sacubitril calcium salt

Sign In for Pricing
View Details
MTX3 Rabbit Polyclonal Antibody
TA338290 100 µL

MTX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Serum Amyloid P, Human (SAP, APCS, PTX2, Mature Chain 204aa, Chromosome 1q21-23) (APC)
MBS6242328-01 0.1 mL

Serum Amyloid P, Human (SAP, APCS, PTX2, Mature Chain 204aa, Chromosome 1q21-23) (APC)

Sign In for Pricing
View Details