Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIC Peptide - C-terminal region

SPIC Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC40611, SPI-C

UniProt

Q8N5J4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPIC Rabbit Polyclonal Antibody (orb574094) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689536

Preservative

Lyophilized powder

AA Sequence

EKLAELWGKRKGNRKTMTYQKMARALRNYGRSGEITKIRRKLTYQFSEAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPM1 polyclonal antibody
BS70897-01 50 µL

DPM1 polyclonal antibody

Sign In for Pricing
View Details
DPM1 polyclonal antibody
BS70897-02 100 µL

DPM1 polyclonal antibody

Sign In for Pricing
View Details
Human Alkaline Phosphatase, Placental, ALPP ELISA KIT
E4383hu-01 48 Well

Human Alkaline Phosphatase, Placental, ALPP ELISA KIT

Sign In for Pricing
View Details
Human Alkaline Phosphatase, Placental, ALPP ELISA KIT
E4383hu-02 96 Well

Human Alkaline Phosphatase, Placental, ALPP ELISA KIT

Sign In for Pricing
View Details
Human Alkaline Phosphatase, Placental, ALPP ELISA KIT
E4383hu-03 5x 96 Tests

Human Alkaline Phosphatase, Placental, ALPP ELISA KIT

Sign In for Pricing
View Details
Human Alkaline Phosphatase, Placental, ALPP ELISA KIT
E4383hu-04 10x 96 Tests

Human Alkaline Phosphatase, Placental, ALPP ELISA KIT

Sign In for Pricing
View Details