Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINT1 Peptide - C-terminal region

SPINT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HAI, HAI1, MANSC2

UniProt

O43278

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_857593

Preservative

Lyophilized powder

AA Sequence

YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUSK Recombinant Rabbit monoclonal Antibody
HA751022 100 µL

MUSK Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 3A1 / CYP3A1 (P6), CF568 conjugate, 0.1mg/mL
BNC683058-100 1x 100 µL

Cytochrome P450 3A1 / CYP3A1 (P6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UPB1 (NM_016327) Human Recombinant Protein
TP720186M 50 µg

UPB1 (NM_016327) Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-Rb (S795) Recombinant Rabbit monoclonal Antibody
HA751113 100 µL

Phospho-Rb (S795) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) ELISA Kit
RDR-TNFRSF5-Ra-01 96 Tests

Rat Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) ELISA Kit

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) ELISA Kit
RDR-TNFRSF5-Ra-02 48 Tests

Rat Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) ELISA Kit

Sign In for Pricing
View Details