Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINT2 Peptide - middle region

SPINT2 Peptide - middle region

Product Specifications

Product Name Alternative

DIAR3, FLJ45571, HAI-2, HAI2, Kop, PB

UniProt

B4DLU1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPINT2 Rabbit Polyclonal Antibody (orb331021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159575

Preservative

Lyophilized powder

AA Sequence

RWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiagNano™ Amine Silica Particles, 200 nm
DNG-F036 10 mL

DiagNano™ Amine Silica Particles, 200 nm

Sign In for Pricing
View Details
MPHOSPH9 Conjugated Antibody
orb1622932 100 µL

MPHOSPH9 Conjugated Antibody

Sign In for Pricing
View Details
FK-866 HCl
OOAU00076-25MG 25 mg

FK-866 HCl

Sign In for Pricing
View Details
pExpress-1-Ufm1 Plasmid
PVT37922 2 µg

pExpress-1-Ufm1 Plasmid

Sign In for Pricing
View Details
Mouse F13b activation kit by CRISPRa
GA201333 1 Kit

Mouse F13b activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Bovine coronavirus Nucleoprotein (N)
CSB-MP329597BJL-01 20 µg

Recombinant Bovine coronavirus Nucleoprotein (N)

Sign In for Pricing
View Details