Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINT2 Peptide - middle region

SPINT2 Peptide - middle region

Product Specifications

Product Name Alternative

DIAR3, FLJ45571, HAI-2, HAI2, Kop, PB

UniProt

B4DLU1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPINT2 Rabbit Polyclonal Antibody (orb331021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159575

Preservative

Lyophilized powder

AA Sequence

RWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECI1 Knockout HEK293T Polyclonal Cells
ARG40390 1 Million

ECI1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Mouse Creld2 Pre-designed siRNA Set A
SI103081A 1 Each

Mouse Creld2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phospho-BAD (S34) Antibody
E45R09138G-4 50 µL

Phospho-BAD (S34) Antibody

Sign In for Pricing
View Details
XFD350 Anti-human CD16 Antibody *3G8*
10161141-AAT 500 Tests

XFD350 Anti-human CD16 Antibody *3G8*

Sign In for Pricing
View Details
ZBTB38 Blocking Peptide
33R-6571 0.1 mg

ZBTB38 Blocking Peptide

Sign In for Pricing
View Details
Cldn16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7102208 1.0 µg DNA

Cldn16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details