Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINT2 Peptide - C-terminal region

SPINT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DIAR3, FLJ45571, HAI-2, HAI2, Kop, PB

UniProt

O43291

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066925

Preservative

Lyophilized powder

AA Sequence

LAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf51 (ANAPC15) Human Gene Knockout Kit (CRISPR)
KN401325 1 Kit

C11orf51 (ANAPC15) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RSAD1 activation kit by CRISPRa
GA110697 1 Kit

Human RSAD1 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Hydroxybutanohydrazide
TRC-B443903-2.5G 2.5 g

3-Hydroxybutanohydrazide

Sign In for Pricing
View Details
LCN9 (NM_001001676) Human Recombinant Protein
TP319914 20 µg

LCN9 (NM_001001676) Human Recombinant Protein

Sign In for Pricing
View Details
Exonuclease 1 (EXO1) Human Gene Knockout Kit (CRISPR)
KN400547 1 Kit

Exonuclease 1 (EXO1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF594 conjugate, 0.1mg/mL
BNC941133-500 1x 500 µL

CD74 (CLIP/1133), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details