Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINT2 Peptide - C-terminal region

SPINT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DIAR3, FLJ45571, HAI-2, HAI2, Kop, PB

UniProt

O43291

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066925

Preservative

Lyophilized powder

AA Sequence

LAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL
BNC402754-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3alpha,6alpha,7alpha-Trihydroxy-5beta-cholanic Acid
TRC-T795105-25MG 25 mg

3alpha,6alpha,7alpha-Trihydroxy-5beta-cholanic Acid

Sign In for Pricing
View Details
2,2'-(Oleylamino)diethanol
TRC-O253070-10MG 10 mg

2,2'-(Oleylamino)diethanol

Sign In for Pricing
View Details
Phospho-CDC37 (S13) Recombinant Rabbit Monoclonal Antibody [SD08-50]
ET1612-74 100 µL

Phospho-CDC37 (S13) Recombinant Rabbit Monoclonal Antibody [SD08-50]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714246 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
ZNF8 Rabbit Polyclonal Antibody
TA369722 100 µL

ZNF8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details